
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: CXCL8
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Gallus gallus (Chicken)
Delivery time: 3-7 business days
Uniprot ID: P08317
AA Sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP
Tag info: NO-tagged
Expression Region: 17-102aa
Protein length: Partial
MW: 9.4 kDa
Alternative Name(s): 9E3 C-X-C motif chemokine 8 CEF-4 Chemokine (C-X-C motif) ligand 8 Embryo fibroblast protein 1
Relevance: May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.
Reference: "Constitutive expression of a gene encoding a polypeptide homologous to biologically active human platelet protein in Rous sarcoma virus-transformed fibroblasts." Bedard P.-A., Alcorta D., Simmons D., Luk K.-C., Erikson R.L. Proc. Natl. Acad. Sci. U.S.A. 84:6715-6719(1987)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.