
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: IFNB
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Gallus gallus (Chicken)
Delivery time: 3-7 business days
Uniprot ID: Q90873
AA Sequence: CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKKQAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFVNQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCFRHVDTLIQWMKSRAPLTASSKRLNTQ
Tag info: N-terminal 6xHis-tagged
Expression Region: 28-203aa
Protein length: Full Length of Mature Protein
MW: 24.8 kDa
Alternative Name(s): IFN2
Relevance: Has antiviral activities.
Reference: "A family of genes coding for two serologically distinct chicken interferons." Sick C., Schultz U., Staeheli P. J. Biol. Chem. 271:7635-7639(1996)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.