Gene Bio Systems
Recombinant Chicken Insulin-induced gene 2 protein(INSIG2)
Recombinant Chicken Insulin-induced gene 2 protein(INSIG2)
SKU:CSB-CF710832CH-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:Q5F3W2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAENDAKPTLPKKSGPYISSVTSRGMNLVIRGIVLFFIGVFLALVLNLLNAVCSGLCQGI NHASAKVDFANNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVSQLLVYNGVY QYTSPDFIYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHED
Protein Names:Recommended name: Insulin-induced gene 2 protein Short name= INSIG-2
Gene Names:Name:INSIG2 ORF Names:RCJMB04_5j21
Expression Region:1-167
Sequence Info:full length protein
