
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Neuroscience
Target / Protein: EN1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Gallus gallus (Chicken)
Delivery time: 3-7 business days
Uniprot ID: Q05916
AA Sequence: MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE
Tag info: N-terminal 6xHis-B2M-tagged
Expression Region: 1-333aa
Protein length: Full Length
MW: 48.5 kDa
Alternative Name(s): Short name:Gg-En-1 Short name:Homeobox protein en-1
Relevance:
Reference: "Cloning and sequence comparison of the mouse, human, and chicken engrailed genes reveal potential functional domains and regulatory regions."Logan C., Hanks M.C., Noble-Topham S., Nallainathan D., Provart N.J., Joyner A.L.Dev. Genet. 13:345-358(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.