Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Calcium release-activated calcium channel protein 1(ORAI1)

Recombinant Chicken Calcium release-activated calcium channel protein 1(ORAI1)

SKU:CSB-CF720018CH

Regular price $2,203.60 CAD
Regular price Sale price $2,203.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZL05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDAEHDYPRGLLIAF SACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTVIG TLLFLAEVVLLCWVKFLPLKKNPLDPAENSNSSITSGQAAAIASTSIMVPFGLIFIVFAV HFYRSLVSHKTDRQFQELNELAEFAWLQDQLDHRGDAISPAVTHFA

Protein Names:Recommended name: Calcium release-activated calcium channel protein 1 Alternative name(s): Protein orai-1 Transmembrane protein 142A

Gene Names:Name:ORAI1 Synonyms:CRACM1, TMEM142A ORF Names:RCJMB04_8f15

Expression Region:1-226

Sequence Info:full length protein

View full details