Gene Bio Systems
Recombinant Chicken Anti-apoptotic protein NR13(NR13)
Recombinant Chicken Anti-apoptotic protein NR13(NR13)
SKU:CSB-CF852696CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:Q90ZN1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPGSLKEETALLLEDYFQHRAGGAALPPSATAAELRRAAAELERRERPFFRSCAPLARAE PREAAALLRKVAAQLEAEGGLNWGRLLALVVFTGTLAAALAESGCEEGPSRLAAALAAYL AEEQGEWLEEHGGWDGFCRFFGRHGSQPADQNSTLSNAIMAAAGFGIAGLAFLLVVR
Protein Names:Recommended name: Anti-apoptotic protein NR13 Alternative name(s): Apoptosis regulator Nr-13
Gene Names:Name:NR13
Expression Region:1-177
Sequence Info:full length protein
