Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chelonia mydas (Green sea-turtle) (Chelonia agassizi)
Uniprot NO.:Q9XPI2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPQLNPAPWFMILSSTWLIYTIILQPKILSHLPTNNPTNKNNKINTNSWTWPWTQHSSTN S
Protein Names:Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8
Gene Names:Name:MT-ATP8 Synonyms:ATP8, ATPASE8, MTATP8
Expression Region:1-61
Sequence Info:full length protein