Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chaetomium globosum Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Chaetomium globosum Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF641286CHI

Regular price $2,198.00 CAD
Regular price Sale price $2,198.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)

Uniprot NO.:Q2GMG9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDRPTQGLTWGPRRDFYNESGSQKIIRKLKEEPLVPIGCILTIAAFTNAYRAMRRGDHH KVQRMFRARVAAQGFTVLAMVGGGMYYAEDRNKRKELGKLKQQQEAEEKRQKWIRELEAR DEEEKALQEMMDKKRKRASERTMRAETGSEGIAAQARAAFKDKANKGEAAGAEKTEAPSQ RADNEKKPAGSGFLGGWFGGSSKTPETPAKDTKGKNLDSESSS

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:CHGG_10835

Expression Region:1-223

Sequence Info:full length protein

View full details