Gene Bio Systems
Recombinant Cellvibrio japonicus UPF0060 membrane protein CJA_3703 (CJA_3703)
Recombinant Cellvibrio japonicus UPF0060 membrane protein CJA_3703 (CJA_3703)
SKU:CSB-CF451495DQY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa)
Uniprot NO.:B3PHW0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKTTLLFVVTALAEIIGCFLPYLWLRKGGSIWLLLPAALSLALFAWLLTLHPTASGRVY AAYGGVYVAVALLWLYWVDGVKLSAYDWAGAAVALLGMAIIAMGWQRS
Protein Names:Recommended name: UPF0060 membrane protein CJA_3703
Gene Names:Ordered Locus Names:CJA_3703
Expression Region:1-108
Sequence Info:full length protein
