Gene Bio Systems
Recombinant Caulobacter crescentus UPF0060 membrane protein CCNA_02055 (CCNA_02055)
Recombinant Caulobacter crescentus UPF0060 membrane protein CCNA_02055 (CCNA_02055)
SKU:CSB-CF488760DQP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caulobacter crescentus (strain NA1000 / CB15N)
Uniprot NO.:B8GX30
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSFAIYVLAALAEIAGCFGFWAWLRLGKSPAWAVLGVLSLVIFALLLTRIEAGAAGRAF AAYGGVYIIASLAWMQVVEGARPDRWDLIGGVICLAGAALILFGPRTN
Protein Names:Recommended name: UPF0060 membrane protein CCNA_02055
Gene Names:Ordered Locus Names:CCNA_02055
Expression Region:1-108
Sequence Info:full length protein
