Skip to product information
1 of 1

GeneBio Systems

Recombinant Cat Junctional adhesion molecule A (F11R), partial

Recombinant Cat Junctional adhesion molecule A (F11R), partial

SKU:Q2WGK2

Regular price $816.00 CAD
Regular price Sale price $816.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q2WGK2

Gene Names: F11R

Alternative Name(s): JAM-A;Junctional adhesion molecule 1;JAM-1;CD antigen CD321

Abbreviation: Recombinant Cat F11R protein, partial

Organism: Felis catus (Cat) (Felis silvestris catus)

Source: E.coli

Expression Region: 29-237aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: AVYTSEPDVRVPEDKPAKLSCSYSGFSNPRVEWKFAHGDITSLVCYKNKITASYADRVTFSHSGITFHSVTRKDTGTYTCMVSDDGGNTYGEVSVQLTVLVPPSKPTVHIPSSATIGSRAVLTCSEKDGSPPSEYYWFKDGVRMPLEPKGNRAFSNSSYSLNEKTGELVFDPVSAWDTGEYTCEAQNGYGMPMRSEAVRMEAAELNVGG

MW: 29.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Ligand for integrin alpha-L/beta-2 involved in memory T-cell and neutrophil transmigration. Involved in platelet activation. ; (Microbial infection) May act as a cellular receptor for calicivirus. ; (Microbial infection) In case of orthoreovirus infection, serves as receptor for the virus.

Reference:

Function:

View full details