Skip to product information
1 of 1

Gene Bio Systems

Recombinant Carica papaya NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

Recombinant Carica papaya NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic

SKU:CSB-CF537822DQH

Regular price $2,018.80 CAD
Regular price Sale price $2,018.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Carica papaya (Papaya)

Uniprot NO.:B1A986

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MLLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDKRQLKGD IFSIFVIAIAAAEAAIGSAIVSSIYRNRKSTRINQSTLLNK

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L

Gene Names:Name:ndhE

Expression Region:1-101

Sequence Info:full length protein

View full details