Gene Bio Systems
Recombinant Capsule biosynthesis protein CapC(capC)
Recombinant Capsule biosynthesis protein CapC(capC)
SKU:CSB-CF325684BQE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:P19581
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFGSDLYIALVLGVTLSLIFTERTGILPAGLVVPGYLALVFNQPVFMLVVLFISILTYVI VTYGVSRFMILYGRRKFAATLITGICLKLLFDYCYPVMPFEIFEFRGIGVIVPGLIANTI QRQGLPLTIGTTILLSGATFAIMNIYYLF
Protein Names:Recommended name: Capsule biosynthesis protein CapC
Gene Names:Name:capC Ordered Locus Names:pXO2-57, BXB0065, GBAA_pXO2_0065
Expression Region:1-149
Sequence Info:full length protein
