Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)
Uniprot NO.:B4UN04
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAVDVPKSVIKKLVFFTVAMVVLPLLTFFTLQHLTSNTIISGGLAALMANVVLVGYIIAA FTEDTTEYAPEGKESKKE
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:VMA21 Ordered Locus Names:CAGL0G07881g
Expression Region:1-78
Sequence Info:full length protein