Recombinant Candida glabrata V-type proton ATPase 16 kDa proteolipid subunit 2(VMA11)

SKU: CSB-CF763775CZI

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Uniprot NO.:Q6FUY5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDMVASDNVYAPLYAPFFGFAGCALAMILSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL IPVVMSGILAIYGLVVAVLIAGNLSPTEEYTLFNGFMHLSCGLCVGFACLSSGYAIGIVG DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIIALILNTKGSE

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit 2 Short name= V-ATPase 16 kDa proteolipid subunit 2 Alternative name(s): Proteolipid protein VMA11 Vacuolar proton pump 16 kDa proteolipid subunit 2

Gene Names:Name:VMA11 Ordered Locus Names:CAGL0E06204g

Expression Region:1-164

Sequence Info:full length protein