Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida albicans Probable endonuclease LCL3(LCL3)

Recombinant Candida albicans Probable endonuclease LCL3(LCL3)

SKU:CSB-CF685502CZD

Regular price $2,216.20 CAD
Regular price Sale price $2,216.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Uniprot NO.:Q5AKW3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPIPAEPTENISIFHPKVLLLSAGVTTSLFFGYKFYKRYIKRIRTYLDLTPSIIENNTK LYGYVTRVGDGDNFRFYHTPGGWFFGWGWLRKIPTTRKDLKDETLMIRLCGVDAPEGAHF GKPAQPYSKEALYWLREYVDGKYVTITPYSIDQYKRVVARAQIWKWTGRKDVSAEMLKVG YAIVYEGKAEAEFGDNEDWYRKLESRAKLLRKGVWSLGKNLTTPGEFKRIHYRGE

Protein Names:Recommended name: Probable endonuclease LCL3 EC= 3.1.-.-

Gene Names:Name:LCL3 ORF Names:CaO19.12481, CaO19.5014

Expression Region:1-235

Sequence Info:full length protein

View full details