Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 3(NAD3)

Recombinant Candida albicans NADH-ubiquinone oxidoreductase chain 3(NAD3)

SKU:CSB-CF860183CZD-GB

Regular price $2,059.40 CAD
Regular price Sale price $2,059.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Uniprot NO.:Q9B8D1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFTFYMYLAPIVAGVLIGLNWLLAKSNPNIDKAGPFECGFTSYQQSRAAFSVAFILVAIL FLPFDLEISSILPYVTSAYNNGLYGLIILIIFLMMLVIAFILEIQLRVLKIERSYDKDRS DSNYYDHEI

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3

Gene Names:Name:NAD3 ORF Names:CaalfMp10

Expression Region:1-129

Sequence Info:full length protein

View full details