Skip to product information
1 of 1

Gene Bio Systems

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 UPF0059 membrane protein Cj0167c(Cj0167c)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 UPF0059 membrane protein Cj0167c(Cj0167c)

SKU:CSB-CF885967CZA

Regular price $2,144.80 CAD
Regular price Sale price $2,144.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)

Uniprot NO.:Q9PIW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDFYSLIFLSCALGMDAFAVSLCKGFSVKKLHLKHYLIVGIYFGGFQALMPTIGYFIGIT FASFIASIDHWIAFILLSLIGLKMIKESLENENCDSNANQFGFKTMLALAIATSIDALAV GVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNKAELLGGLVLIILGVKIL IEHLFFD

Protein Names:Recommended name: UPF0059 membrane protein Cj0167c

Gene Names:Ordered Locus Names:Cj0167c

Expression Region:1-187

Sequence Info:full length protein

View full details