Skip to product information
1 of 1

Gene Bio Systems

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Sec-independent protein translocase protein TatC(tatC)

Recombinant Campylobacter jejuni subsp. jejuni serotype O:2 Sec-independent protein translocase protein TatC(tatC)

SKU:CSB-CF879226CZA

Regular price $2,231.60 CAD
Regular price Sale price $2,231.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168)

Uniprot NO.:Q9PHT8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFEELRPHLIELRKRLFISVACIVVMFIVCFALRSYILDILKAPLIAVLPEVAKHVNVIE VQEALFTAMKVSFFAAFIFSLPVIFWQFWKFVAPGLYDNEKRLVVPFVSFASIMFAFGAC FCYFVVVPLAFKFLINFGLNEDFNPVITIGTYVDFFTKVVVAFGLAFEMPVIAFFFAKIG LIDDSFLKRHFRIAVLVIFVFSAFMTPPDVLSQFLMAGPLCGLYGLSILIVQKVNPAPKD KESDE

Protein Names:Recommended name: Sec-independent protein translocase protein TatC

Gene Names:Name:tatC Synonyms:mttB Ordered Locus Names:Cj0578c

Expression Region:1-245

Sequence Info:full length protein

View full details