Gene Bio Systems
Recombinant Campylobacter hominis Protein CrcB homolog(crcB)
Recombinant Campylobacter hominis Protein CrcB homolog(crcB)
SKU:CSB-CF418999CWD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A)
Uniprot NO.:A7I227
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFYTILCVGTGGFVGAILRFLFYFGFAQFFSQKYIFIATICVNIIGSFIIGFVLNIATTY AINYNFKNFLVTGLLGALTTFSTFTYENAVFLNHGEISKFFLNITMSIILCLIFCFLGIY TAKIIH
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:CHAB381_1007
Expression Region:1-126
Sequence Info:full length protein
