Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Campylobacter concisus (strain 13826)
Uniprot NO.:A8Z6E7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIGLTHYLILASLVFVIGLVGIMRRRNLIMLFFSSEILLNSANIALAAISKYYFDLTGQI IAFFIVAIAASEVAVGLGLLVLWYKKTGSISLDSMTNMKG
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K
Gene Names:Name:nuoK Ordered Locus Names:Ccon26_01950 ORF Names:CCC13826_1666
Expression Region:1-100
Sequence Info:full length protein