Recombinant Calotropis procera Osmotin, partial

SKU: P86363

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P86363

Gene Names: N/A

Alternative Name(s): (CpOsm)(Fragment)

Abbreviation: Recombinant Calotropis procera Osmotin protein, partial

Organism: Calotropis procera (Roostertree) (Asclepias procera)

Source: E.coli

Expression Region: 1-40aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-KSI-tagged

Target Protein Sequence: ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA

MW: 19.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Has antifungal activity. Inhibits spore germination and mycelia growth in F.solani (IC(50)=67.0 ug/ml), C.gloeosporioides (IC(50)=32.1 ug/ml) and a Neurospora isolate (IC(50)=57.5 ug/ml).

Reference: "Osmotin purified from the latex of Calotropis procera: Biochemical characterization, biological activity and role in plant defense." Teixeira de Freitas C.D., Sousa Nogueira F.C., Vasconcelos I.M., Abreu Oliveira J.T., Domont G.B., Ramos M.V. Plant Physiol. Biochem. 49: 738-743(2011)

Function: