Skip to product information
1 of 1

Gene Bio Systems

Recombinant Callithrix jacchus Interleukin-10(IL10)

Recombinant Callithrix jacchus Interleukin-10(IL10)

SKU:CSB-YP611872CYL

Regular price $1,637.40 CAD
Regular price Sale price $1,637.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q0Z972

Gene Names: IL10

Organism: Callithrix jacchus (White-tufted-ear marmoset)

AA Sequence: SPGQGTQSENSCTHFPGSLPHMLRELRVAFSRVKTFFQKKDQLDSMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGEKLKTFRLRLRRCHRFLPCENKSKAVVQVKNAVSKLQEKGIYKAMSEFDIFIDYIEAYMTMKAQN

Expression Region: 19-178aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 20.6 kDa

Alternative Name(s): Cytokine synthesis inhibitory factor ;CSIF

Relevance: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Reference: Common marmoset interleukin 10.Yamabe E., Kohu K., Suemizu H., Sasaki E., Tanioka Y., Yagita H., Habu S., Satake M.

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details