Gene Bio Systems
Recombinant Burkholderia xenovorans UPF0060 membrane protein Bxeno_B1021(Bxeno_B1021)
Recombinant Burkholderia xenovorans UPF0060 membrane protein Bxeno_B1021(Bxeno_B1021)
SKU:CSB-CF621721BNV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Burkholderia xenovorans (strain LB400)
Uniprot NO.:Q13PK0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKTFLLYAVTAVAEIVGCYLPWRWLKEGGSIWLLVPGALSLALFAWLLTLHGTAAGRVYA AYGGVYVAVAIAWLWCVDKVRPTLWDAAGVVFTLAGMAIIAFQPRV
Protein Names:Recommended name: UPF0060 membrane protein Bxeno_B1021
Gene Names:Ordered Locus Names:Bxeno_B1021 ORF Names:Bxe_B1996
Expression Region:1-106
Sequence Info:full length protein
