Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia phytofirmans Probable intracellular septation protein A (Bphyt_1922)

Recombinant Burkholderia phytofirmans Probable intracellular septation protein A (Bphyt_1922)

SKU:CSB-CF454799BXU

Regular price $2,129.40 CAD
Regular price Sale price $2,129.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Burkholderia phytofirmans (strain DSM 17436 / PsJN)

Uniprot NO.:B2T419

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFLFDLFPIILFFVAFKIWGIFTATAVAIVATLVQIAWVAFRHRKVDPMLWVSLGVVTV FGGATLVLHNDTFIKWKPTVLYWAFSVALIVSQLAFNKNLIEAMMGKQITLPHAIWGKLS VVWAIFFVLLGLVNLFVAYNYTTDQWVNFKLFGATGCLVVFIVGQSLWLSKYMKEE

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Bphyt_1922

Expression Region:1-176

Sequence Info:full length protein

View full details