Gene Bio Systems
Recombinant Burkholderia cepacia Probable intracellular septation protein A (BceJ2315_19460)
Recombinant Burkholderia cepacia Probable intracellular septation protein A (BceJ2315_19460)
SKU:CSB-CF455645BXS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Burkholderia cepacia (strain J2315 / LMG 16656) (Burkholderia cenocepacia (strain J2315))
Uniprot NO.:B4EBL0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKFLFDLFPIILFFVAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFSKNLIEKMMGKQLTLPSPVWDKLN LAWALFFAVLGVANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:BceJ2315_19460 ORF Names:BCAL1983
Expression Region:1-176
Sequence Info:full length protein
