
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Microbiology
Target / Protein: N
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Bunyavirus La Crosse
Delivery time: 3-7 business days
Uniprot ID: P04873
AA Sequence: MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP
Tag info: N-terminal 6xHis-tagged
Expression Region: 1-235aa
Protein length: Full Length
MW: 28.5 kDa
Alternative Name(s): Nucleocapsid protein
Relevance: Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation
Reference: "Structural basis for encapsidation of genomic RNA by La Crosse Orthobunyavirus nucleoprotein." Reguera J., Malet H., Weber F., Cusack S. Proc. Natl. Acad. Sci. U.S.A. 110:7246-7251(2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.