Recombinant Bunodosoma granuliferum Delta-actitoxin-Bgr2a

SKU: P0C1F4

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P0C1F4

Gene Names: N/A

Alternative Name(s): Delta-AITX-Bgr2a;Bg II;BgII;Neurotoxin Bg-2

Abbreviation: Recombinant Bunodosoma granuliferum Delta-actitoxin-Bgr2a protein

Organism: Bunodosoma granuliferum (Red warty sea anemone)

Source: E.coli

Expression Region: 1-48aa

Protein Length: Full Length

Tag Info: N-terminal GST-tagged

Target Protein Sequence: GASCRCDSDGPTSRGNTLTGTLWLIGRCPSGWHNCRGSGPFIGYCCKQ

MW: 31.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Binds voltage-dependently at site 3 of sodium channels (Nav) and inhibits the inactivation of the activated channels, thereby blocking neuronal transmission. Possesses the highest efficacy for the insect sodium channel para/tipE (EC(50)=5.5 nM), and has effect on Nav1.2/SCN2A (in complex with SCN1B), Nav1.4/SCN4A (in complex with SCN1B) and Nav1.5/SCN5A (in complex with SCN1B.

Reference:

Function: