Recombinant Bufo marinus Sodium-potassium-transporting ATPase subunit beta-2

SKU: CSB-CF002327BXI

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bufo marinus (Giant toad) (Cane toad)

Uniprot NO.:P43002

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAALTQKKTCSQMMEEWKEFMWNPRTREFMGRTGSSWALILLFYVVFYAFLTAVFSLSLWVMLQTIDEYTPKYADRLANPGLMIRPKMDTTEVVYSTNGMNGTWQAYVDNLNSLLKDYNKTVQMERGVNCTPGVYNMQEDTGDVRNNPKKACWFFRDVLGDCSGVSDTTYGYQDGKPCVLIKMNRVINFLPVPIKELSNTSITIKCTAQNNDDLLGSIQYFPSVNNQSLGAIDLMYFPYYGNRAQQNYTQPFVAVKFLNATKGVDHMVECRVNAANINNQDPRDLYQGRVIFTMKIDRL

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-2 Alternative name(s): Beta-B1 chain Sodium/potassium-dependent ATPase beta-2 subunit

Gene Names:

Expression Region:1-299

Sequence Info:full length protein