Gene Bio Systems
Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0092 membrane protein BUsg_126(BUsg_126)
Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0092 membrane protein BUsg_126(BUsg_126)
SKU:CSB-CF815731BXE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Uniprot NO.:Q8KA08
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFFIKDANAAVNQALEGNSYSLIFMLVTFILIFYFMLFRPQQKKDKEHKNLMNSIAPGD EVMTTSGFLGRVKKVTENGYVLLQLNNTTEIFIKKDFIVSSLPKGTLESL
Protein Names:Recommended name: UPF0092 membrane protein BUsg_126
Gene Names:Ordered Locus Names:BUsg_126
Expression Region:1-110
Sequence Info:full length protein
