Recombinant Buchnera aphidicola subsp. Schizaphis graminum  Cytochrome o ubiquinol oxidase protein CyoD(cyoD)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Cytochrome o ubiquinol oxidase protein CyoD(cyoD)

CSB-CF809136BXE
Regular price
$1,449.00 CAD
Sale price
$1,449.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:Q8K996

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKYKKIKNNFDKEKKSYIVGFLFSLFLTIIPFFCTLNHLFSRKINFFVILLCALSQIII HFIYFLHLDFSKKNSWNIISLLFILIIVFIIVFGSIWIMYNLNHHVIL

Protein Names:Recommended name: Cytochrome o ubiquinol oxidase protein CyoD

Gene Names:Name:cyoD Ordered Locus Names:BUsg_453

Expression Region:1-108

Sequence Info:full length protein

Your list is ready to share