Gene Bio Systems
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae NADH-quinone oxidoreductase subunit J(nuoJ)
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae NADH-quinone oxidoreductase subunit J(nuoJ)
SKU:CSB-CF807177BMZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Uniprot NO.:Q89AT8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEFFFYSSSLATIVFTVCSIFSRNLMYSLLYLILSFVFTSCVFFSLGATFAAALEVIIYA GAIMVLFVFFIMMFNFKKSTLYAEKIFDKNNYYYINFLFLLCILIFPFFFILSYLYKEKI FYMVVSTKLVAIKLFSDYILVIELSSIVLLSALIIVSHIGKIRR
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit J EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit J NDH-1 subunit J
Gene Names:Name:nuoJ Ordered Locus Names:bbp_151
Expression Region:1-164
Sequence Info:full length protein
