Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0056 membrane protein BU267 (BU267)

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum UPF0056 membrane protein BU267 (BU267)

SKU:CSB-CF348785BWZ

Regular price $2,186.80 CAD
Regular price Sale price $2,186.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Uniprot NO.:P57355

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNISIFDLSIYIKFFIGLCALVNPIGMIPIFTTMTNNQSFLERKKTNIVANFSVSLILLI SLFFGSNILNIFGISINSFRIAGGILIISIAFSMISGQFIKTIKTKKETKEENKIDNISV VPLAMPLIAGPGAISSTIVWSTYYSSWANLFLCSLVIFLFSFVCWLCFEAAPYVVQILGN TGINIITRIMGLLLMSLGIEFISTGIGAIFPGLLH

Protein Names:Recommended name: UPF0056 membrane protein BU267

Gene Names:Ordered Locus Names:BU267

Expression Region:1-215

Sequence Info:full length protein

View full details