Recombinant Brugia malayi Protein JTB(JTB),partial

Recombinant Brugia malayi Protein JTB(JTB),partial

CSB-EP011970BMV
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: O77049

Gene Names: JTB

Organism: Brugia malayi (Filarial nematode worm)

AA Sequence: EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL

Expression Region: 31-105aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.4 kDa

Alternative Name(s):

Relevance: Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly

Reference: "JTB: a novel membrane protein gene at 1q21 rearranged in a jumping translocation."Hatakeyama S., Osawa M., Omine M., Ishikawa F.Oncogene 18:2085-2090(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share