Gene Bio Systems
Recombinant Brucella suis biovar 1 Protein CrcB homolog 4(crcB4)
Recombinant Brucella suis biovar 1 Protein CrcB homolog 4(crcB4)
SKU:CSB-CF815316BMQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brucella suis biovar 1 (strain 1330)
Uniprot NO.:Q8FVL9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFF ATLTGPEGRWLVSPAWRQFVMGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFL SLSAAMLGLIAAQRINR
Protein Names:Recommended name: Protein CrcB homolog 4
Gene Names:Name:crcB4 Ordered Locus Names:BRA0818, BS1330_II0811
Expression Region:1-137
Sequence Info:full length protein
