Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella suis biovar 1 Lectin-like protein BA14k(BRA0735, BS1330_II0728)

Recombinant Brucella suis biovar 1 Lectin-like protein BA14k(BRA0735, BS1330_II0728)

SKU:CSB-CF818007BMQ

Regular price $2,048.20 CAD
Regular price Sale price $2,048.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brucella suis biovar 1 (strain 1330)

Uniprot NO.:Q8FVU0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R

Protein Names:Recommended name: Lectin-like protein BA14k

Gene Names:Ordered Locus Names:BRA0735, BS1330_II0728

Expression Region:27-147

Sequence Info:full length protein

View full details