Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella ovis Probable intracellular septation protein A (BOV_1862)

Recombinant Brucella ovis Probable intracellular septation protein A (BOV_1862)

SKU:CSB-CF404228BPI

Regular price $2,193.80 CAD
Regular price Sale price $2,193.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)

Uniprot NO.:A5VSR0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHPVFERDPSEKSETERREVPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAP IFLATALFMAATVIALAISWSMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIV NTLFGGILLGGLFFGKSLLGYVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFS TDTWVSFKVWGIMPITIVFTLLQMPLIQKHSLTDEENTAS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:BOV_1862

Expression Region:1-220

Sequence Info:full length protein

View full details