Gene Bio Systems
Recombinant Brucella ovis Lectin-like protein BA14k (BOV_A0688)
Recombinant Brucella ovis Lectin-like protein BA14k (BOV_A0688)
SKU:CSB-CF405061BPI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Uniprot NO.:A5VV34
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R
Protein Names:Recommended name: Lectin-like protein BA14k
Gene Names:Ordered Locus Names:BOV_A0688
Expression Region:27-147
Sequence Info:full length protein
