Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella melitensis biotype 1 Probable intracellular septation protein A(BMEI0130)

Recombinant Brucella melitensis biotype 1 Probable intracellular septation protein A(BMEI0130)

SKU:CSB-CF849179BMO

Regular price $2,164.40 CAD
Regular price Sale price $2,164.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Uniprot NO.:Q8YJF3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAPIFLATALFMAATVIALAISW SMTRTLAIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIVNTLFGGILLGGLFFGKSLLG YVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFSTDTWVSFKVWGIMPITIVFT LLQMPLIQKHSLTDEENTAS

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:BMEI0130

Expression Region:1-200

Sequence Info:full length protein

View full details