Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brucella melitensis biotype 1 Aquaporin Z(aqpZ)

Recombinant Brucella melitensis biotype 1 Aquaporin Z(aqpZ)

SKU:CSB-CF873227BMO

Regular price $2,206.40 CAD
Regular price Sale price $2,206.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Uniprot NO.:Q9L772

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGG HFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYG ELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAGFAPIAIGFGLTLIHLVSIPVTN TWVNPARSTGVALFADTAALSQLWLFWVAPLVGAVIGAIIWKGLLGRD

Protein Names:Recommended name: Aquaporin Z

Gene Names:Name:aqpZ Ordered Locus Names:BMEI0070

Expression Region:1-228

Sequence Info:full length protein

View full details