Skip to product information
1 of 1

Gene Bio Systems

Recombinant Brassica napus Oleosin-B2(OlnB2)

Recombinant Brassica napus Oleosin-B2(OlnB2)

SKU:CSB-CF339025BWD

Regular price $1,986.60 CAD
Regular price Sale price $1,986.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Brassica napus (Rape)

Uniprot NO.:P29526

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LQSPLRKIIVNRIKARLGGGGGGSRLARLKKILGLLNKLRGMGAGGAAAPAAEPAPAAEA APAAEAAPAAAPAAAPAAAP

Protein Names:Recommended name: Oleosin-B2 Alternative name(s): Oleosin-C98 Cleaved into the following chain: 1. Pollen coat protein B2

Gene Names:Name:OlnB2 Synonyms:C98

Expression Region:104-183

Sequence Info:full length protein

View full details