Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium sp. Large-conductance mechanosensitive channel(mscL)

Recombinant Bradyrhizobium sp. Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF396851BPF

Regular price $2,073.40 CAD
Regular price Sale price $2,073.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bradyrhizobium sp. (strain ORS278)

Uniprot NO.:A4YWD8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MLKEFREFAMKGNVVDLAVGVIIGGAFGAIVTSLVGDIIMPIIGAITGGLDFSNYFIPLA KSVTATNLADAKKQGAVLAYGSFLTLTLNFFIVAFVLFMVIRGMNKLKRRQEAAPAAPPK PSAEVELLTEIRDLLKKA

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:BRADO4474

Expression Region:1-138

Sequence Info:full length protein

View full details