Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium japonicum Heme exporter protein D(cycX)

Recombinant Bradyrhizobium japonicum Heme exporter protein D(cycX)

SKU:CSB-CF330039BVW

Regular price $1,958.60 CAD
Regular price Sale price $1,958.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bradyrhizobium japonicum (strain USDA 110)

Uniprot NO.:P30959

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIMSLGPYASFIVTSYAAAALVVAILIGWIATDYRSQTRRLRDLDRSGITRRSGRSAMDR P

Protein Names:Recommended name: Heme exporter protein D Alternative name(s): Cytochrome c-type biogenesis protein CycX

Gene Names:Name:cycX Synonyms:ccmD Ordered Locus Names:bsr0470

Expression Region:1-61

Sequence Info:full length protein

View full details