Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bradyrhizobium japonicum ATP synthase subunit b-b'(atpG)

Recombinant Bradyrhizobium japonicum ATP synthase subunit b-b'(atpG)

SKU:CSB-CF804690BVW

Regular price $2,144.80 CAD
Regular price Sale price $2,144.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bradyrhizobium japonicum (strain USDA 110)

Uniprot NO.:Q89V70

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAESHGGAKGPAAGAHTGAEGGHGGGFPPFESSTYASQLVSLAIFFVVLYVIVSKLALPK VGGAIEARQNKIEGDLAEAQTLRDQSDAALKAYESELASARSRAQAIGNESRDKANAQAE TERKALEEQLAAKLAGAEKTIASTRTAAMSNVRGIAADAAGQIVQQLTGVVPDAASVNAA VDASLKG

Protein Names:Recommended name: ATP synthase subunit b/b' Alternative name(s): ATP synthase F(0) sector subunit b/b' ATPase subunit II F-type ATPase subunit b/b' Short name= F-ATPase subunit b/b'

Gene Names:Name:atpG Ordered Locus Names:bll1186

Expression Region:1-187

Sequence Info:full length protein

View full details