Gene Bio Systems
Recombinant Bovine Vesicle transport protein GOT1B(GOLT1B)
Recombinant Bovine Vesicle transport protein GOT1B(GOLT1B)
SKU:CSB-CF650554BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q2YDE3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFF QKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLN LPGIRSFVDKVGESNNMV
Protein Names:Recommended name: Vesicle transport protein GOT1B Alternative name(s): Golgi transport 1 homolog B
Gene Names:Name:GOLT1B
Expression Region:1-138
Sequence Info:full length protein
