Gene Bio Systems
Recombinant Bovine Vesicle-associated membrane protein-associated protein B(VAPB)
Recombinant Bovine Vesicle-associated membrane protein-associated protein B(VAPB)
SKU:CSB-CF025790BO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:A2VDZ9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIIPTTASKTETPTVSKALSSSLDDTEVKKVMEECKRLQSEVQRLREENKQFKEEDGLRMRKTAQSNSPAPASAMAGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Protein Names:Recommended name: Vesicle-associated membrane protein-associated protein B Short name= VAMP-B Short name= VAMP-associated protein B Short name= VAP-B
Gene Names:Name:VAPB
Expression Region:2-243
Sequence Info:full length protein
