Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Vesicle-associated membrane protein 2(VAMP2)

Recombinant Bovine Vesicle-associated membrane protein 2(VAMP2)

SKU:CSB-CF025781BO

Regular price $2,038.40 CAD
Regular price Sale price $2,038.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P63026

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFSS

Protein Names:Recommended name: Vesicle-associated membrane protein 2 Short name= VAMP-2 Alternative name(s): Synaptobrevin-2

Gene Names:Name:VAMP2 Synonyms:SYB2

Expression Region:2-116

Sequence Info:full length protein

View full details