Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine V-type proton ATPase subunit e 2(ATP6V0E2)

Recombinant Bovine V-type proton ATPase subunit e 2(ATP6V0E2)

SKU:CSB-CF642525BO

Regular price $1,775.00 CAD
Regular price Sale price $1,775.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:Q2KIB5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAHSFALPVVIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE

Protein Names:Recommended name: V-type proton ATPase subunit e 2 Short name= V-ATPase subunit e 2 Alternative name(s): Vacuolar proton pump subunit e 2

Gene Names:Name:ATP6V0E2

Expression Region:1-81

Sequence Info:full length protein

View full details