Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Uroplakin-3a(UPK3A)

Recombinant Bovine Uroplakin-3a(UPK3A)

SKU:CSB-CF025657BO

Regular price $2,266.60 CAD
Regular price Sale price $2,266.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:P38574

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSAALHGTYEVYLYVLVDSASFRNASVQDSTKTPLSSTFQQTQGGRTGPYKAAAFDLTPCSDSPSLDAVRDVSRASEILNAYLIRVGTNGTCLLDPNFQGLCNPPLSAATEYRFKYVLVNMSSGLVQDQTLWSDPIRTDRLTLYSAIDTWPGRRSGGMIVITSILGSLPFFLLIGFAGAIVLSLVDRGDADGATSHDSQITQEAVPKSLGTSEPSYTSVNRGPSLDRAEVYASKLQD

Protein Names:Recommended name: Uroplakin-3a Short name= UP3a Alternative name(s): Uroplakin III Short name= UPIII

Gene Names:Name:UPK3A Synonyms:UPK3

Expression Region:19-287

Sequence Info:full length protein

View full details