Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bovine Transmembrane protein 218(TMEM218)

Recombinant Bovine Transmembrane protein 218(TMEM218)

SKU:CSB-CF023812BO

Regular price $2,038.40 CAD
Regular price Sale price $2,038.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bos taurus (Bovine)

Uniprot NO.:A5PJF4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGTVLGVGAGVFVLALLWVSVLLLCALLFRASGAARFSVIFVFLGALIVTAILLLFPRA SDAPAPEAETKIVDAFFIGRYVLLAFLTAVFLGSLFLVLIHHILEPIYAKPLRSY

Protein Names:Recommended name: Transmembrane protein 218

Gene Names:Name:TMEM218

Expression Region:1-115

Sequence Info:Full length protein

View full details